PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012573840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 227aa    MW: 25745.2 Da    PI: 5.9914
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012573840.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.34e-28959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+i+n + rqvtfskRr g++KKAeELSvLC+a+va+iifsstgkl+eys+
  XP_012573840.1  9 KKINNATARQVTFSKRRRGLFKKAEELSVLCEADVALIIFSSTGKLFEYSN 59
                    689**********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.483161IPR002100Transcription factor, MADS-box
SMARTSM004322.4E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-29375IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-25323IPR002100Transcription factor, MADS-box
PfamPF003194.2E-251057IPR002100Transcription factor, MADS-box
CDDcd002653.16E-321377No hitNo description
PRINTSPR004041.1E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-253859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.11487177IPR002487Transcription factor, K-box
PfamPF014866.4E-1693171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MAKEKIKIKK INNATARQVT FSKRRRGLFK KAEELSVLCE ADVALIIFSS TGKLFEYSNL  60
SMREILERHH LHSKNLAKPE EPSLELQLVE NINCSRLSKE IAEKSHQLRQ MRGEDLHGLN  120
VEELQQLERS LEIGLERVME TKGEKIMMEI NALQRKGMQL MEENDRLKQH LANMNNGNMF  180
GGDESENVVN EEGQSSESVT NVCNSTGPPQ DYESSDTSLK LGLPYAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-17393288Myocyte-specific enhancer factor 2A
3kov_B2e-17393288Myocyte-specific enhancer factor 2A
3kov_I2e-17393288Myocyte-specific enhancer factor 2A
3kov_J2e-17393288Myocyte-specific enhancer factor 2A
3p57_A2e-17393288Myocyte-specific enhancer factor 2A
3p57_B2e-17393288Myocyte-specific enhancer factor 2A
3p57_C2e-17393288Myocyte-specific enhancer factor 2A
3p57_D2e-17393288Myocyte-specific enhancer factor 2A
3p57_I2e-17393288Myocyte-specific enhancer factor 2A
3p57_J2e-17393288Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012573840.11e-166PREDICTED: MADS-box protein SVP-like
RefseqXP_012573841.11e-166PREDICTED: MADS-box protein SVP-like
SwissprotQ9FVC11e-112SVP_ARATH; MADS-box protein SVP
TrEMBLG7JXQ91e-140G7JXQ9_MEDTR; MADS-box transcription factor
STRINGGLYMA02G04710.11e-132(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF89033106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-106MIKC_MADS family protein